PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009780690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 367aa    MW: 41639.6 Da    PI: 7.5426
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009780690.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.3e-1085125545
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                     k++rr+++NReAAr+sR RKka++++Le+   +L +  ++L
  XP_009780690.1  85 KVQRRLAQNREAARKSRMRKKAYVQQLETSRMKLAQLEMEL 125
                     99**************************9776666665544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-581141IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.23283127IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.31E-785124No hitNo description
Gene3DG3DSA:1.20.5.1705.4E-885128No hitNo description
PfamPF001702.1E-785125IPR004827Basic-leucine zipper domain
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
PfamPF141442.1E-28172244IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MNMSSPSTQF APTTRMGIFE PFHHMSIWED TFRGDIMPGT GACMVAQPND RVNDRVDDKS  60
GYTSSEQLIP SGSEDNQAGK SVSEKVQRRL AQNREAARKS RMRKKAYVQQ LETSRMKLAQ  120
LEMELERARQ QGLYVLGSNG NMGLSATINP GIAAFEIEYG LWVEEQQKKN VELRNVLQSH  180
VSEMELQLLV ESVLSQYYNL FRMKADAAKA DVFYLMSGMW RTSVERFFLW IGGFKPSELI  240
NVVMPQLEPL SDQQIVKICN LRHCCQQAED ALTQGMDKLQ QTLAQSILTM TTGMGSYSSQ  300
MLSSMEKLEA LESFVNQADH LRHQTLQQMS LILTTRQTAR GLLAFGEYLQ RLRALSSLWA  360
ARPREPT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780690.10.0PREDICTED: transcription factor TGA1
RefseqXP_016503964.10.0PREDICTED: transcription factor TGA1-like
SwissprotQ392371e-154TGA1_ARATH; Transcription factor TGA1
TrEMBLM1BF040.0M1BF04_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000436490.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-155bZIP family protein